|
Proteintech
c6219 myh7 proteintech C6219 Myh7 Proteintech, supplied by Proteintech, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/c6219 myh7 proteintech/product/Proteintech Average 96 stars, based on 1 article reviews
c6219 myh7 proteintech - by Bioz Stars,
2026-03
96/100 stars
|
Buy from Supplier |
|
Thermo Fisher
β myosin heavy chain βmhc mm00600555 β Myosin Heavy Chain βmhc Mm00600555, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/β myosin heavy chain βmhc mm00600555/product/Thermo Fisher Average 86 stars, based on 1 article reviews
β myosin heavy chain βmhc mm00600555 - by Bioz Stars,
2026-03
86/100 stars
|
Buy from Supplier |
|
Transgenic Rabbit Models
transgenic rabbit β-myhc-q403 ![]() Transgenic Rabbit β Myhc Q403, supplied by Transgenic Rabbit Models, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/transgenic rabbit β-myhc-q403/product/Transgenic Rabbit Models Average 90 stars, based on 1 article reviews
transgenic rabbit β-myhc-q403 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
Transgenic Rabbit Models
mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human hcm ![]() Mutant β Myosin Heavy Chain Glutamic Acid 403 Transgenic Rabbit Model Of Human Hcm, supplied by Transgenic Rabbit Models, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human hcm/product/Transgenic Rabbit Models Average 90 stars, based on 1 article reviews
mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human hcm - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
Peptide Protein Research Ltd
rlc binding site peptide of the human β-cardiac myosin heavy chain encompassing amino acids 805–837 (errdsllviqwnirafmgvknwpwmklyfkik) ![]() Rlc Binding Site Peptide Of The Human β Cardiac Myosin Heavy Chain Encompassing Amino Acids 805–837 (Errdsllviqwnirafmgvknwpwmklyfkik), supplied by Peptide Protein Research Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/rlc binding site peptide of the human β-cardiac myosin heavy chain encompassing amino acids 805–837 (errdsllviqwnirafmgvknwpwmklyfkik)/product/Peptide Protein Research Ltd Average 90 stars, based on 1 article reviews
rlc binding site peptide of the human β-cardiac myosin heavy chain encompassing amino acids 805–837 (errdsllviqwnirafmgvknwpwmklyfkik) - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
Novocastra
primary antibody against sarcomeric beta-myosin heavy chain ![]() Primary Antibody Against Sarcomeric Beta Myosin Heavy Chain, supplied by Novocastra, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/primary antibody against sarcomeric beta-myosin heavy chain/product/Novocastra Average 90 stars, based on 1 article reviews
primary antibody against sarcomeric beta-myosin heavy chain - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
Enzo Biochem
β-myosin heavy chain or β-mhc ![]() β Myosin Heavy Chain Or β Mhc, supplied by Enzo Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/β-myosin heavy chain or β-mhc/product/Enzo Biochem Average 90 stars, based on 1 article reviews
β-myosin heavy chain or β-mhc - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
Absolute Biotech Inc
mab beta myosin heavy chain ![]() Mab Beta Myosin Heavy Chain, supplied by Absolute Biotech Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/mab beta myosin heavy chain/product/Absolute Biotech Inc Average 90 stars, based on 1 article reviews
mab beta myosin heavy chain - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
ClinGen Resource
beta myosin heavy chain ![]() Beta Myosin Heavy Chain, supplied by ClinGen Resource, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/beta myosin heavy chain/product/ClinGen Resource Average 90 stars, based on 1 article reviews
beta myosin heavy chain - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
Qiagen
β-myosin heavy chain (β-mhc ![]() β Myosin Heavy Chain (β Mhc, supplied by Qiagen, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/β-myosin heavy chain (β-mhc/product/Qiagen Average 90 stars, based on 1 article reviews
β-myosin heavy chain (β-mhc - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
ALFARES Pharmaceuticals
β-myosin heavy chain ![]() β Myosin Heavy Chain, supplied by ALFARES Pharmaceuticals, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/β-myosin heavy chain/product/ALFARES Pharmaceuticals Average 90 stars, based on 1 article reviews
β-myosin heavy chain - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
MAICON ASSOCIATES LIMITED
reduced beta myosin heavy chain k213 acetylation and t215 phosphorylation ![]() Reduced Beta Myosin Heavy Chain K213 Acetylation And T215 Phosphorylation, supplied by MAICON ASSOCIATES LIMITED, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/reduced beta myosin heavy chain k213 acetylation and t215 phosphorylation/product/MAICON ASSOCIATES LIMITED Average 90 stars, based on 1 article reviews
reduced beta myosin heavy chain k213 acetylation and t215 phosphorylation - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
Image Search Results
Journal:
Article Title: Molecular genetics and pathogenesis of hypertrophic cardiomyopathy
doi:
Figure Lengend Snippet: Genetically engineered animal models of HCM
Article Snippet: After 6 months of exercise hypertrophy,
Techniques: Activity Assay, Knock-Out, Transgenic Assay, Expressing
Journal: Heart Failure Reviews
Article Title: Myofilament dysfunction in diastolic heart failure
doi: 10.1007/s10741-023-10352-z
Figure Lengend Snippet: Animal models of myofilament mutations causing diastolic heart failure
Article Snippet: , MYH7 , β-MyHC (myosin mutation R723G) , Thick filament (Cardiac ventricles; slow-twitch skeletal muscle) , mutant β-myosin heavy chain-glutamic acid 403
Techniques: Animal Model, Knock-Out, Mutagenesis, Transgenic Assay, Activity Assay
Journal: PLoS ONE
Article Title: Hydrogen Sulfide Suppresses Outward Rectifier Potassium Currents in Human Pluripotent Stem Cell-Derived Cardiomyocytes
doi: 10.1371/journal.pone.0050641
Figure Lengend Snippet: A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, β-MHC and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
Article Snippet: Sigma), β-myosin heavy chain or
Techniques: Light Microscopy, Immunocytochemistry, Staining, Derivative Assay