beta myosin heavy chain Search Results


96
Proteintech c6219 myh7 proteintech
C6219 Myh7 Proteintech, supplied by Proteintech, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/c6219 myh7 proteintech/product/Proteintech
Average 96 stars, based on 1 article reviews
c6219 myh7 proteintech - by Bioz Stars, 2026-03
96/100 stars
  Buy from Supplier

86
Thermo Fisher β myosin heavy chain βmhc mm00600555
β Myosin Heavy Chain βmhc Mm00600555, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/β myosin heavy chain βmhc mm00600555/product/Thermo Fisher
Average 86 stars, based on 1 article reviews
β myosin heavy chain βmhc mm00600555 - by Bioz Stars, 2026-03
86/100 stars
  Buy from Supplier

90
Transgenic Rabbit Models transgenic rabbit β-myhc-q403
Genetically engineered animal models of HCM
Transgenic Rabbit β Myhc Q403, supplied by Transgenic Rabbit Models, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/transgenic rabbit β-myhc-q403/product/Transgenic Rabbit Models
Average 90 stars, based on 1 article reviews
transgenic rabbit β-myhc-q403 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Transgenic Rabbit Models mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human hcm
Animal models of myofilament mutations causing diastolic heart failure
Mutant β Myosin Heavy Chain Glutamic Acid 403 Transgenic Rabbit Model Of Human Hcm, supplied by Transgenic Rabbit Models, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human hcm/product/Transgenic Rabbit Models
Average 90 stars, based on 1 article reviews
mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human hcm - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Peptide Protein Research Ltd rlc binding site peptide of the human β-cardiac myosin heavy chain encompassing amino acids 805–837 (errdsllviqwnirafmgvknwpwmklyfkik)
Animal models of myofilament mutations causing diastolic heart failure
Rlc Binding Site Peptide Of The Human β Cardiac Myosin Heavy Chain Encompassing Amino Acids 805–837 (Errdsllviqwnirafmgvknwpwmklyfkik), supplied by Peptide Protein Research Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/rlc binding site peptide of the human β-cardiac myosin heavy chain encompassing amino acids 805–837 (errdsllviqwnirafmgvknwpwmklyfkik)/product/Peptide Protein Research Ltd
Average 90 stars, based on 1 article reviews
rlc binding site peptide of the human β-cardiac myosin heavy chain encompassing amino acids 805–837 (errdsllviqwnirafmgvknwpwmklyfkik) - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Novocastra primary antibody against sarcomeric beta-myosin heavy chain
Animal models of myofilament mutations causing diastolic heart failure
Primary Antibody Against Sarcomeric Beta Myosin Heavy Chain, supplied by Novocastra, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/primary antibody against sarcomeric beta-myosin heavy chain/product/Novocastra
Average 90 stars, based on 1 article reviews
primary antibody against sarcomeric beta-myosin heavy chain - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Enzo Biochem β-myosin heavy chain or β-mhc
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
β Myosin Heavy Chain Or β Mhc, supplied by Enzo Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/β-myosin heavy chain or β-mhc/product/Enzo Biochem
Average 90 stars, based on 1 article reviews
β-myosin heavy chain or β-mhc - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Absolute Biotech Inc mab beta myosin heavy chain
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
Mab Beta Myosin Heavy Chain, supplied by Absolute Biotech Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mab beta myosin heavy chain/product/Absolute Biotech Inc
Average 90 stars, based on 1 article reviews
mab beta myosin heavy chain - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
ClinGen Resource beta myosin heavy chain
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
Beta Myosin Heavy Chain, supplied by ClinGen Resource, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/beta myosin heavy chain/product/ClinGen Resource
Average 90 stars, based on 1 article reviews
beta myosin heavy chain - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Qiagen β-myosin heavy chain (β-mhc
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
β Myosin Heavy Chain (β Mhc, supplied by Qiagen, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/β-myosin heavy chain (β-mhc/product/Qiagen
Average 90 stars, based on 1 article reviews
β-myosin heavy chain (β-mhc - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
ALFARES Pharmaceuticals β-myosin heavy chain
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
β Myosin Heavy Chain, supplied by ALFARES Pharmaceuticals, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/β-myosin heavy chain/product/ALFARES Pharmaceuticals
Average 90 stars, based on 1 article reviews
β-myosin heavy chain - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
MAICON ASSOCIATES LIMITED reduced beta myosin heavy chain k213 acetylation and t215 phosphorylation
A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, <t>β-MHC</t> and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.
Reduced Beta Myosin Heavy Chain K213 Acetylation And T215 Phosphorylation, supplied by MAICON ASSOCIATES LIMITED, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/reduced beta myosin heavy chain k213 acetylation and t215 phosphorylation/product/MAICON ASSOCIATES LIMITED
Average 90 stars, based on 1 article reviews
reduced beta myosin heavy chain k213 acetylation and t215 phosphorylation - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

Image Search Results


Genetically engineered animal models of HCM

Journal:

Article Title: Molecular genetics and pathogenesis of hypertrophic cardiomyopathy

doi:

Figure Lengend Snippet: Genetically engineered animal models of HCM

Article Snippet: After 6 months of exercise hypertrophy, myofibrillar disarray 105 Transgenic rabbit β-MyHC-Q403 Cardiac hypertrophy, myocyte disarray, interstitial fibrosis, increased mortality and SCD, systolic and diastolic dysfunction, preserved global systolic function, reduced myocardial contraction and relaxation velocities 106 , 118 Open in a separate window [Ca +2 ]I: Intracellular Ca +2 concentration; [PCr]: phosphocreatinine; ↑[Pi]: Inorganic phosphate; −/−: null (homozygous for the deletion); +/−: heterozygous, LCBD: Light chain binding domain, MyHC: myosin heavy chain; cTnT: Cardiac troponin T: cTnI: Cardiac troponin I; MyBP-C: Myosin binding protein C, ELC: Essential light chain.

Techniques: Activity Assay, Knock-Out, Transgenic Assay, Expressing

Animal models of myofilament mutations causing diastolic heart failure

Journal: Heart Failure Reviews

Article Title: Myofilament dysfunction in diastolic heart failure

doi: 10.1007/s10741-023-10352-z

Figure Lengend Snippet: Animal models of myofilament mutations causing diastolic heart failure

Article Snippet: , MYH7 , β-MyHC (myosin mutation R723G) , Thick filament (Cardiac ventricles; slow-twitch skeletal muscle) , mutant β-myosin heavy chain-glutamic acid 403 transgenic rabbit model of human HCM , [ ] .

Techniques: Animal Model, Knock-Out, Mutagenesis, Transgenic Assay, Activity Assay

A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, β-MHC and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.

Journal: PLoS ONE

Article Title: Hydrogen Sulfide Suppresses Outward Rectifier Potassium Currents in Human Pluripotent Stem Cell-Derived Cardiomyocytes

doi: 10.1371/journal.pone.0050641

Figure Lengend Snippet: A: Light microscopy and immunocytochemistry image of H9 hESC-CMs dissociated from contracting EBs. Scale bar: 100 µm. Fluorescent images of H9 hESC-CMs stained with antibodies against α-actinin, β-MHC and Titin showed typical cardiac sarcomeres. Scale bar: 30 µm. B1∼2: Action potential trace of three subtypes of cardiomyocytes derived from H9 hESCs and corresponding specific action potential properties. APA: action potential amplitude. dV/dt max : maximal rate of depolarization or maximal upstroke velocity. APD50: action potential duration at 50%. APD90: action potential duration at 90%.

Article Snippet: Sigma), β-myosin heavy chain or β-MHC (Alexis Biochemicals, FL, USA) followed by Alexa Fluo® 488 goat anti-rabbit IgG (Invitrogen, CA, USA); and cardiac Titin (1∶10) (Sigma-Alrich, MO, USA) followed by Alexa Fluo® 555 donkey anti-rabbit IgG.

Techniques: Light Microscopy, Immunocytochemistry, Staining, Derivative Assay